Engineered streptavidin variant (acgr) in complex with the strep-tag ii peptide
PDB DOI: 10.2210/pdb6qw4/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Bifidobacterium Dentium (Strain Atcc 27534 / Dsm 20436 / Jcm 1195 / Bd1) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-03-05 Deposition Author(s): Eichinger, A. , Skerra, A.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Engineered streptavidin variant (acgr) in complex with the strep-tag ii peptide
Primary Citation of Related Structures: 6QW4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Streptavidin | A | 127 | Bifidobacterium Dentium (Strain Atcc 27534 / Dsm 20436 / Jcm 1195 / Bd1) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MEAGITGTWYNQLGSTFIVTAGADGALTGTYACGRGNAECRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS |
Strep-tag II peptide | P | 12 | Bifidobacterium Dentium (Strain Atcc 27534 / Dsm 20436 / Jcm 1195 / Bd1) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XSAWSHPQFEKX |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-03-05 Deposition Author(s): Eichinger, A. , Skerra, A.