Nmr solution structure of lsr2 binding domain.
PDB DOI: 10.2210/pdb6qkp/pdb
Classification: DNA BINDING PROTEIN Organism(s): Mycobacterium Tuberculosis (Strain Atcc 25618 / H37Rv)
Deposited: 2019-01-30 Deposition Author(s): Barthe, P. , Cohen-Gonsaud, M. , Mukamolova, G.V.
Nmr solution structure of lsr2 binding domain.
Barthe, P. , Cohen-Gonsaud, M. , Mukamolova, G.V.
Primary Citation of Related Structures: 6QKP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nucleoid-associated protein Lsr2 | A | 50 | Mycobacterium Tuberculosis (Strain Atcc 25618 / H37Rv) | GHMSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT |
Method: SOLUTION NMR
Deposited Date: 2019-01-30 Deposition Author(s): Barthe, P. , Cohen-Gonsaud, M. , Mukamolova, G.V.