Cryo-em structure of heparin-induced 2n4r tau twister filaments
PDB DOI: 10.2210/pdb6qjm/pdb
Classification: PROTEIN FIBRIL Organism(s): Homo Sapiens
Deposited: 2019-01-24 Deposition Author(s): Crowther, R.A. , Falcon, B. , Fan, J. , Goedert, M. , Murzin, A.G. , Scheres, S.H.W. , Zhang, W.
Method: ELECTRON MICROSCOPY Resolution: 3.3 Å
Cryo-em structure of heparin-induced 2n4r tau twister filaments
Crowther, R.A. , Falcon, B. , Fan, J. , Goedert, M. , Murzin, A.G. , Scheres, S.H.W. , Zhang, W.
Primary Citation of Related Structures: 6QJM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Microtubule-associated protein tau | A | 48 | Homo Sapiens | KVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK |
Microtubule-associated protein tau | B | 48 | Homo Sapiens | KVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK |
Microtubule-associated protein tau | C | 48 | Homo Sapiens | KVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK |
Method: ELECTRON MICROSCOPY
Deposited Date: 2019-01-24 Deposition Author(s): Crowther, R.A. , Falcon, B. , Fan, J. , Goedert, M. , Murzin, A.G. , Scheres, S.H.W. , Zhang, W.