6Q86
Structure of fucosylated d-antimicrobial peptide sb4 in complex with the fucose-binding lectin pa-iil at 2.008 angstrom resolution
PDB DOI: 10.2210/pdb6q86/pdb
Classification: ANTIBIOTIC Organism(s): Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-12-14 Deposition Author(s): Baeriswyl, S. , Reymond, J.L. , Stocker, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.008 Å
Structure of fucosylated d-antimicrobial peptide sb4 in complex with the fucose-binding lectin pa-iil at 2.008 angstrom resolution
Baeriswyl, S. , Reymond, J.L. , Stocker, A.
Primary Citation of Related Structures: 6Q86
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fucose-binding lectin | A | 114 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG |
| Fucose-binding lectin | B | 114 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG |
| SB4 | C | 13 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KYKKALKKLAKLL |
| SB4 | D | 13 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KYKKALKKLAKLL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-12-14 Deposition Author(s): Baeriswyl, S. , Reymond, J.L. , Stocker, A.