6PXC
N-terminal sh2 domain of the p120rasgap bound to a p190rhogap phosphotyrosine peptide
PDB DOI: 10.2210/pdb6pxc/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-07-25 Deposition Author(s): Boggon, T.J. , Jaber Chehayeb, R. , Stiegler, A.L.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
N-terminal sh2 domain of the p120rasgap bound to a p190rhogap phosphotyrosine peptide
Boggon, T.J. , Jaber Chehayeb, R. , Stiegler, A.L.
Primary Citation of Related Structures: 6PXC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ras GTPase-activating protein 1 | A | 109 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMSGDYYIGGRRFSSLSDLIGYYSHVSSLLKGEKLLYPVAPPEPVED |
| phosphopeptide of p190RhoGAP | U | 14 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XEEENIYSVPHDST |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2019-07-25 Deposition Author(s): Boggon, T.J. , Jaber Chehayeb, R. , Stiegler, A.L.