Backbone-modified variant of zinc finger 2 from the transcription factor sp1 dna binding domain: d-pro in the metal-binding turn
PDB DOI: 10.2210/pdb6pv0/pdb
Classification: DNA BINDING PROTEIN Organism(s): N.A.
Deposited: 2019-07-19 Deposition Author(s): Horne, W.S. , Rao, S.R.
Method: SOLUTION NMR Resolution: N.A.
Backbone-modified variant of zinc finger 2 from the transcription factor sp1 dna binding domain: d-pro in the metal-binding turn
Primary Citation of Related Structures: 6PV0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor Sp1 | A | 32 | N.A. | RPFLCTWPGCGKRFTRSDELQRHKRTHTGEKX |
Method: SOLUTION NMR
Deposited Date: 2019-07-19 Deposition Author(s): Horne, W.S. , Rao, S.R.