Crystal structure of unsaturated fatty acid bound wild-type toxt from vibrio cholerae strain sce256
PDB DOI: 10.2210/pdb6p7r/pdb
Classification: DNA BINDING PROTEIN Organism(s): Vibrio Cholerae
Deposited: 2019-06-06 Deposition Author(s): Cruite, J.T. , Kull, F.J.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of unsaturated fatty acid bound wild-type toxt from vibrio cholerae strain sce256
Primary Citation of Related Structures: 6P7R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Toxin co-regulated pilus virulence regulatory protein | A | 277 | Vibrio Cholerae | MRENNTSFLVNVYDLKKFDTYAFNKVFIDDYKIFWINKGSAKLVDKNCLVSYTITASSVVLLKKNSIQRFSLMSLSDESISVCVLTIKNKFVNSLRHYLQGDLMIRNLYNEKKDLLLWNCELNDISVLGEIVSTYDQTQYSEDFLKIFFSGFFSKVEKKYNSIFITDDLDAMEKISCLVKSDITRNWRWADICGELRTNRMILKKELESRGVKFRELINSIRISYSISLMKTGEFKIKQIAYQSGFASVSYFSTVFKSTMNVAPSEYLFMLTGVAEE |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-06-06 Deposition Author(s): Cruite, J.T. , Kull, F.J.