Crystal structure of the tir domain g601p mutant from human sarm1, crystal form 1
PDB DOI: 10.2210/pdb6o1b/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2019-02-18 Deposition Author(s): Boden, M. , Bosanac, T. , Burdett, H. , Casey, L. , Chen, J. , Coleman, M.P. , Dodds, P.N. , Dry, I.B. , Ericsson, D.J. , Foley, G. , Gilley, J. , Gu, W. , Horsefield, S. , Hughes, R.O. , Kobe, B. , Lai, J. , Manik, M.K. , Nanson, J.D. , Rank, M. , Rathjen, J.P. , Shi, Y. , Staskawicz, B.J. , Tiancong, Q. , Ve, T. , Von Itzstein, M. , Williams, S.J. , Zhang, X.
Crystal structure of the tir domain g601p mutant from human sarm1, crystal form 1
Boden, M. , Bosanac, T. , Burdett, H. , Casey, L. , Chen, J. , Coleman, M.P. , Dodds, P.N. , Dry, I.B. , Ericsson, D.J. , Foley, G. , Gilley, J. , Gu, W. , Horsefield, S. , Hughes, R.O. , Kobe, B. , Lai, J. , Manik, M.K. , Nanson, J.D. , Rank, M. , Rathjen, J.P. , Shi, Y. , Staskawicz, B.J. , Tiancong, Q. , Ve, T. , Von Itzstein, M. , Williams, S.J. , Zhang, X.
Primary Citation of Related Structures: 6O1B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sterile alpha and TIR motif-containing protein 1 | A | 144 | Homo Sapiens | SNADTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAPKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-02-18 Deposition Author(s): Boden, M. , Bosanac, T. , Burdett, H. , Casey, L. , Chen, J. , Coleman, M.P. , Dodds, P.N. , Dry, I.B. , Ericsson, D.J. , Foley, G. , Gilley, J. , Gu, W. , Horsefield, S. , Hughes, R.O. , Kobe, B. , Lai, J. , Manik, M.K. , Nanson, J.D. , Rank, M. , Rathjen, J.P. , Shi, Y. , Staskawicz, B.J. , Tiancong, Q. , Ve, T. , Von Itzstein, M. , Williams, S.J. , Zhang, X.