Crystal structure of pho7 complex with pho1 promoter site 2
PDB DOI: 10.2210/pdb6o19/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Schizosaccharomyces Pombe , Synthetic Construct
Deposited: 2019-02-18 Deposition Author(s): Garg, A. , Goldgur, Y. , Shuman, S.
Method: X-RAY DIFFRACTION Resolution: 1.596 Å
Crystal structure of pho7 complex with pho1 promoter site 2
Garg, A. , Goldgur, Y. , Shuman, S.
Primary Citation of Related Structures: 6O19
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor Pho7 | A | 59 | Schizosaccharomyces Pombe , Synthetic Construct | SGKVKKRLPQAKRACAKCQKDNKKCDDARPCQRCIKAKTDCIDLPRKKRPTGVRRGPYK |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-02-18 Deposition Author(s): Garg, A. , Goldgur, Y. , Shuman, S.