Nmr structure of the dna binding domain of ehmybs3
PDB DOI: 10.2210/pdb6nvz/pdb
Classification: DNA BINDING PROTEIN Organism(s): Entamoeba Histolytica
Deposited: 2019-02-05 Deposition Author(s): Del Rio-Portilla, F. , Titaux-Delgado, G.A.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the dna binding domain of ehmybs3
Del Rio-Portilla, F. , Titaux-Delgado, G.A.
Primary Citation of Related Structures: 6NVZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Myb family DNA-binding protein shaqkyf family | A | 60 | Entamoeba Histolytica | GPLGSKKREVWTDAEHAKFVEGLALFHKDWKKIKEYIGTKTVVQIRSHAQKYFLKLNKTA |
Method: SOLUTION NMR
Deposited Date: 2019-02-05 Deposition Author(s): Del Rio-Portilla, F. , Titaux-Delgado, G.A.