6NSX
Yeast hsh155 ligand bound to human tat-sf1 motif
PDB DOI: 10.2210/pdb6nsx/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-01-25 Deposition Author(s): Jenkins, J.L. , Kielkopf, C.L. , Leach, J.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2 Å
Yeast hsh155 ligand bound to human tat-sf1 motif
Jenkins, J.L. , Kielkopf, C.L. , Leach, J.R.
Primary Citation of Related Structures: 6NSX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV Tat-specific factor 1 | A | 94 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDY |
| Hsh155 | B | 6 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SRWDVK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2019-01-25 Deposition Author(s): Jenkins, J.L. , Kielkopf, C.L. , Leach, J.R.