Crystal structure of de novo designed metal-controlled dimer of mutant b1 immunoglobulin-binding domain of streptococcal protein g (l12h, t16l, v29h, y33h, n37l)-zinc
PDB DOI: 10.2210/pdb6nl8/pdb
Classification: METAL BINDING PROTEIN Organism(s): Streptococcus
Deposited: 2019-01-08 Deposition Author(s): Huxford, T. , Maniaci, B. , Stec, B.
Crystal structure of de novo designed metal-controlled dimer of mutant b1 immunoglobulin-binding domain of streptococcal protein g (l12h, t16l, v29h, y33h, n37l)-zinc
Huxford, T. , Maniaci, B. , Stec, B.
Primary Citation of Related Structures: 6NL8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein G | A | 56 | Streptococcus | MTYKLILNGKTHKGELTTEAVDAATAEKHFKQHANDLGVDGEWTYDDATKTFTVTE |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-01-08 Deposition Author(s): Huxford, T. , Maniaci, B. , Stec, B.