PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6NHY

Structure of the transmembrane domain of the death receptor 5 mutant (g217y) - trimer only

PDB DOI: 10.2210/pdb6nhy/pdb

Classification: IMMUNE SYSTEM
Organism(s): Homo Sapiens

Deposited: 2018-12-24
Deposition Author(s): Chen, W. , Chou, J.J. , Fu, T. , Liu, Z. , Pan, L. , Piai, A. , Wu, H. , Zhao, L.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

6nhy
Literature

Structure of the transmembrane domain of the death receptor 5 mutant (g217y) - trimer only

Chen, W. , Chou, J.J. , Fu, T. , Liu, Z. , Pan, L. , Piai, A. , Wu, H. , Zhao, L.

Primary Citation of Related Structures: 6NHY


Proteins
Molecule Chains Sequence Length Organism Sequence
Tumor necrosis factor receptor superfamily member 10B A 36 Homo Sapiens MPGSLSGIIIYVTVAAVVLIVAVFVCKSLLWKKVLP
Tumor necrosis factor receptor superfamily member 10B B 36 Homo Sapiens MPGSLSGIIIYVTVAAVVLIVAVFVCKSLLWKKVLP
Tumor necrosis factor receptor superfamily member 10B C 36 Homo Sapiens MPGSLSGIIIYVTVAAVVLIVAVFVCKSLLWKKVLP
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2018-12-24
Deposition Author(s): Chen, W. , Chou, J.J. , Fu, T. , Liu, Z. , Pan, L. , Piai, A. , Wu, H. , Zhao, L.