Structure of hiv tat-specific factor 1 u2af homology motif bound to sf3b1 ulm5
PDB DOI: 10.2210/pdb6n3f/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-11-15 Deposition Author(s): Jenkins, J.L. , Kielkopf, C.L. , Leach, J.R.
Structure of hiv tat-specific factor 1 u2af homology motif bound to sf3b1 ulm5
Jenkins, J.L. , Kielkopf, C.L. , Leach, J.R.
Primary Citation of Related Structures: 6N3F
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
HIV Tat-specific factor 1 | A | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDY |
HIV Tat-specific factor 1 | C | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDY |
SF3b1 U2AF ligand motif | D | 4 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SRWD |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-11-15 Deposition Author(s): Jenkins, J.L. , Kielkopf, C.L. , Leach, J.R.