6N3E
Structure of hiv tat-specific factor 1 u2af homology motif bound to u2af ligand motif 4
PDB DOI: 10.2210/pdb6n3e/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-11-15 Deposition Author(s): Jenkins, J.L. , Kielkopf, C.L. , Loerch, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.893 Å
Structure of hiv tat-specific factor 1 u2af homology motif bound to u2af ligand motif 4
Jenkins, J.L. , Kielkopf, C.L. , Loerch, S.
Primary Citation of Related Structures: 6N3E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV Tat-specific factor 1 | A | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDY |
| SF3b1 U2AF ligand motif | B | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NRWDETP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-11-15 Deposition Author(s): Jenkins, J.L. , Kielkopf, C.L. , Loerch, S.