Crystal structure of p62 zz domain in complex with arg-glu peptide
PDB DOI: 10.2210/pdb6miu/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2018-09-20 Deposition Author(s): Ahn, J. , Kutateladze, T.G. , Zhang, Y.
Crystal structure of p62 zz domain in complex with arg-glu peptide
Ahn, J. , Kutateladze, T.G. , Zhang, Y.
Primary Citation of Related Structures: 6MIU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sequestosome-1, Arg-Glu peptide chimera | A | 57 | Homo Sapiens | RELGSNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSP |
| Sequestosome-1, Arg-Glu peptide chimera | B | 57 | Homo Sapiens | RELGSNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSP |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-20 Deposition Author(s): Ahn, J. , Kutateladze, T.G. , Zhang, Y.