Dhp1 chromodomain y24w variant bound to histone h3 peptide containing trimethyllysine
PDB DOI: 10.2210/pdb6mha/pdb
Classification: PROTEIN BINDING Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2018-09-17 Deposition Author(s): Albanese, K.I. , Brustad, E.M. , Krone, M.W. , Waters, M.L.
Method: X-RAY DIFFRACTION Resolution: 1.497 Å
Dhp1 chromodomain y24w variant bound to histone h3 peptide containing trimethyllysine
Albanese, K.I. , Brustad, E.M. , Krone, M.W. , Waters, M.L.
Primary Citation of Related Structures: 6MHA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Heterochromatin protein 1 | A | 53 | Drosophila Melanogaster , Synthetic Construct | EEWAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR |
| histone H3 peptide containing trimethyllysine, H3K9me3 | B | 6 | Drosophila Melanogaster , Synthetic Construct | QTARKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-17 Deposition Author(s): Albanese, K.I. , Brustad, E.M. , Krone, M.W. , Waters, M.L.