Dhp1 chromodomain y24w variant bound to histone h3 peptide containing trimethyllysine
PDB DOI: 10.2210/pdb6mha/pdb
Classification: PROTEIN BINDING Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-09-17 Deposition Author(s): Albanese, K.I. , Brustad, E.M. , Krone, M.W. , Waters, M.L.
Dhp1 chromodomain y24w variant bound to histone h3 peptide containing trimethyllysine
Albanese, K.I. , Brustad, E.M. , Krone, M.W. , Waters, M.L.
Primary Citation of Related Structures: 6MHA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Heterochromatin protein 1 | A | 53 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EEWAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR |
histone H3 peptide containing trimethyllysine, H3K9me3 | B | 6 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QTARKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-17 Deposition Author(s): Albanese, K.I. , Brustad, E.M. , Krone, M.W. , Waters, M.L.