C-terminal bzip domain of human c/ebpbeta with 16bp methylated oligonucleotide containing consensus recognition sequence-c2 crystal form
PDB DOI: 10.2210/pdb6mg1/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-09-12 Deposition Author(s): Cheng, X. , Horton, J.R. , Yang, J.
C-terminal bzip domain of human c/ebpbeta with 16bp methylated oligonucleotide containing consensus recognition sequence-c2 crystal form
Cheng, X. , Horton, J.R. , Yang, J.
Primary Citation of Related Structures: 6MG1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CCAAT/enhancer-binding protein beta | A | 78 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HMKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGH |
CCAAT/enhancer-binding protein beta | B | 78 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HMKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGH |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-12 Deposition Author(s): Cheng, X. , Horton, J.R. , Yang, J.