Crystal structure of arabidopsis arid5 phd finger in complex with h3k4me3 peptide
PDB DOI: 10.2210/pdb6lqe/pdb
Classification: GENE REGULATION Organism(s): Arabidopsis Thaliana , Synthetic Construct
Deposited: 2020-01-13 Deposition Author(s): Du, J. , Liu, R.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| AT-rich interactive domain-containing protein 4 | A | 76 | Arabidopsis Thaliana , Synthetic Construct | SDGECCLICRSSTAGDWVNCGSCGEWAHFGCDRRPGLGAFKDYAKTDGLEYVCPNCSVSNYRKKSQKTSNGGLLVP |
| 15-mer peptide from Histone H3.2 | P | 15 | Arabidopsis Thaliana , Synthetic Construct | ARTKQTARKSTGGKA |
Method: X-RAY DIFFRACTION