X-ray structure of human galectin-10 in complex with d-arabinose
PDB DOI: 10.2210/pdb6l6c/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2019-10-28 Deposition Author(s): Kamitori, S.
X-ray structure of human galectin-10 in complex with d-arabinose
Primary Citation of Related Structures: 6L6C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Galectin-10 | A | 144 | Homo Sapiens | GSMSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-10-28 Deposition Author(s): Kamitori, S.