Crystal structure of phf20l1 tudor1 in complex with k142me1 dnmt1
PDB DOI: 10.2210/pdb6l1f/pdb
Classification: METAL BINDING PROTEIN/PEPTIDE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-09-29 Deposition Author(s): Gao, J. , Lv, M.Q.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
the K142me1 DNMT1 peptide | A | 6 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RSKSDG |
PHD finger protein 20-like protein 1 | B | 70 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLER |
Method: X-RAY DIFFRACTION