Crystal structure of a streptococcal protein g b1 mutant
PDB DOI: 10.2210/pdb6kmc/pdb
Classification: IMMUNE SYSTEM Organism(s): Dermatophagoides Farinae
Deposited: 2019-07-31 Deposition Author(s): Honda, S. , Watanabe, H.
Crystal structure of a streptococcal protein g b1 mutant
Primary Citation of Related Structures: 6KMC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Immunoglobulin G-binding protein G B1 | A | 57 | Dermatophagoides Farinae | MDTYKLILNGKTLKGETTTEAVDAAHAEKVFKHYANEHGVHGHWTYDPETKTFTVTE |
Immunoglobulin G-binding protein G B1 | B | 57 | Dermatophagoides Farinae | MDTYKLILNGKTLKGETTTEAVDAAHAEKVFKHYANEHGVHGHWTYDPETKTFTVTE |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-07-31 Deposition Author(s): Honda, S. , Watanabe, H.