Solution structure of plectasin derivative mp1102
PDB DOI: 10.2210/pdb6k51/pdb
Classification: ANTIBIOTIC Organism(s): N.A.
Deposited: 2019-05-28 Deposition Author(s): Liu, X.H. , Mao, R.Y. , Wang, J.H.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of plectasin derivative mp1102
Liu, X.H. , Mao, R.Y. , Wang, J.H.
Primary Citation of Related Structures: 6K51
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| plectasin derivative MP1102 | A | 40 | N.A. | GFGCNGPWQEDDLKCHNHCKSIKGYKGGYCAKGGFVCKCY |
Method: SOLUTION NMR
Deposited Date: 2019-05-28 Deposition Author(s): Liu, X.H. , Mao, R.Y. , Wang, J.H.