Crystal structure of mth1 in complex with 18-crown-6
PDB DOI: 10.2210/pdb6imz/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2018-10-24 Deposition Author(s): Kitakami, R. , Kosaka, Y. , Matsumoto, K. , Mizuguchi, M. , Nabeshima, Y. , Yokoyama, T.
Crystal structure of mth1 in complex with 18-crown-6
Kitakami, R. , Kosaka, Y. , Matsumoto, K. , Mizuguchi, M. , Nabeshima, Y. , Yokoyama, T.
Primary Citation of Related Structures: 6IMZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 7,8-dihydro-8-oxoguanine triphosphatase | A | 163 | Homo Sapiens | MASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTVLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-10-24 Deposition Author(s): Kitakami, R. , Kosaka, Y. , Matsumoto, K. , Mizuguchi, M. , Nabeshima, Y. , Yokoyama, T.