6I2G
Alfa-tag binding nanobody (nbalfa) bound to alfa-tag peptide.
PDB DOI: 10.2210/pdb6i2g/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Pyrobaculum Ferrireducens , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-11-01 Deposition Author(s): Martinez-Carranza, M. , Stenmark, P.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Alfa-tag binding nanobody (nbalfa) bound to alfa-tag peptide.
Martinez-Carranza, M. , Stenmark, P.
Primary Citation of Related Structures: 6I2G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ALFA nanobody | A | 124 | Pyrobaculum Ferrireducens , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SGEVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVMVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHVLEDRVDSFHDYWGQGTQVTVSS |
| N7P-SER-ARG-LEU-GLU-GLU-GLU-LEU-ARG-ARG-ARG-LEU-THR-GLU-LPD | B | 15 | Pyrobaculum Ferrireducens , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PSRLEEELRRRLTEP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-11-01 Deposition Author(s): Martinez-Carranza, M. , Stenmark, P.