Crystal structure of the protein-kinase a catalytic subunit from cricetulus griseus in complex with compounds rkp153 and fasudil
PDB DOI: 10.2210/pdb6i2a/pdb
Classification: TRANSFERASE Organism(s): Cricetulus Griseus , Synthetic Construct
Deposited: 2018-11-01 Deposition Author(s): Heine, A. , Klebe, G. , Mueller, J.M.
Crystal structure of the protein-kinase a catalytic subunit from cricetulus griseus in complex with compounds rkp153 and fasudil
Heine, A. , Klebe, G. , Mueller, J.M.
Primary Citation of Related Structures: 6I2A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase catalytic subunit alpha | A | 353 | Cricetulus Griseus , Synthetic Construct | GHMGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF |
| UPF0418 protein FAM164A | D | 18 | Cricetulus Griseus , Synthetic Construct | TTYADFIASGRTGRRDAI |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-11-01 Deposition Author(s): Heine, A. , Klebe, G. , Mueller, J.M.