The ligand-free, open structure of cd0873, a substrate binding protein with adhesive properties from clostridium difficile.
PDB DOI: 10.2210/pdb6hnk/pdb
Classification: TRANSPORT PROTEIN Organism(s): Peptoclostridium Difficile 630
Deposited: 2018-09-15 Deposition Author(s): Acharya, K.R. , Bradshaw, W.J. , Harmer, N.J. , Kovacs-Simon, A. , Michell, S.L.
The ligand-free, open structure of cd0873, a substrate binding protein with adhesive properties from clostridium difficile.
Acharya, K.R. , Bradshaw, W.J. , Harmer, N.J. , Kovacs-Simon, A. , Michell, S.L.
Primary Citation of Related Structures: 6HNK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ABC-type transport system, sugar-family extracellular solute-binding protein | A | 319 | Peptoclostridium Difficile 630 | SMASQGGDSGNSKQESNSKDKEVKKIGITQLVEHPALDATRTGFVKALEKNGFKDGENIDIDFQNAQNDMPTTQSIASKFASDKKDLIFAISTPSAQAAFNATKDIPILITAVSDPVAAGLVKTLEKPGTNVSGTSDFVSVDKGLELLKIFAPKAKTIGVMYNTSEVNSKVQVDALKEYASKNGFKVVEKGITTSNEVNQGISSLVGKIDVLYVPTDNLVASSMPIVSKIATENKIPVIAAESGPVEKGALACQGINYEKLGYKTGEMAVKILNGESVSDMPVATSDDTDIIVNEDILKALGMEKPSNENISYVKTKQE |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-15 Deposition Author(s): Acharya, K.R. , Bradshaw, W.J. , Harmer, N.J. , Kovacs-Simon, A. , Michell, S.L.