Crystal structure of a single-domain cyclophilin from brassica napus phloem sap
PDB DOI: 10.2210/pdb6hmz/pdb
Classification: ISOMERASE Organism(s): Brassica Napus , Synthetic Construct
Deposited: 2018-09-13 Deposition Author(s): Betzel, C. , Falke, S. , Garbe, M. , Hanhart, P. , Kehr, J. , Thiess, M.
Crystal structure of a single-domain cyclophilin from brassica napus phloem sap
Betzel, C. , Falke, S. , Garbe, M. , Hanhart, P. , Kehr, J. , Thiess, M.
Primary Citation of Related Structures: 6HMZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase | X | 180 | Brassica Napus , Synthetic Construct | MANPKVFFDILIGKMKAGRVVMELFADVTPRTADNFRALCTGEKGIGQAGKALHYKGSAFHRIIPGFMCQGGDFTRGNGTGGESIYGAKFQDENFKLKHTGPGILSMANSGPNTNGSQFFICTDKTAWLDGKHVVFGKVVDGYNVVKAMEKVGSERGVTSEPVVIEDCGEIKNETSEVSN |
| Cyclosporin | A | 11 | Brassica Napus , Synthetic Construct | TAGLVLAALLV |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-13 Deposition Author(s): Betzel, C. , Falke, S. , Garbe, M. , Hanhart, P. , Kehr, J. , Thiess, M.