The solution structure of the micelle-associated fatc domain of the human protein kinase ataxia telangiectasia mutated (atm)
PDB DOI: 10.2210/pdb6hka/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica , Pseudomonas Taiwanensis Dsm 21245
Deposited: 2018-09-06 Deposition Author(s): Abd Rahim, M.S. , Dames, S.A.
The solution structure of the micelle-associated fatc domain of the human protein kinase ataxia telangiectasia mutated (atm)
Primary Citation of Related Structures: 6HKA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Immunoglobulin G-binding protein G,Serine-protein kinase ATM | A | 100 | Salmonella Enterica , Pseudomonas Taiwanensis Dsm 21245 | MQYKLALNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTELVPRGSDDDDKTVLSVGGQVNLLIQQAIDPKNLSRLFPGWKAWV |
Method: SOLUTION NMR
Deposited Date: 2018-09-06 Deposition Author(s): Abd Rahim, M.S. , Dames, S.A.