Structure of the rec114 ph domain
PDB DOI: 10.2210/pdb6hfg/pdb
Classification: RECOMBINATION Organism(s): Mus Musculus
Deposited: 2018-08-21 Deposition Author(s): De Massy, B. , Juarez-Martinez, A.B. , Kadlec, J.
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
Structure of the rec114 ph domain
De Massy, B. , Juarez-Martinez, A.B. , Kadlec, J.
Primary Citation of Related Structures: 6HFG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Meiotic recombination protein REC114 | B | 147 | Mus Musculus | AMGEVSQWSLKRYGRFMLLDNVGSPGPSSEAAAAGSPTWKVFESSEESGSLVLTIVVSGHFFISQGQTLLEGFSLIGSKNWLKIVRRMDCLLFGTTIKNKSRMFRVQFSGESKEEALERCCGCVQTLAQYVTVQEPDSTTQELQQSQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-08-21 Deposition Author(s): De Massy, B. , Juarez-Martinez, A.B. , Kadlec, J.