Crystal structure of paf - p-sulfonatocalix[8]arene complex
PDB DOI: 10.2210/pdb6haj/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Penicillium Rubens Wisconsin 54-1255
Deposited: 2018-08-07 Deposition Author(s): Alex, J.M. , Batta, G. , Crowley, P.B. , Engilberge, S. , Rennie, M.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Crystal structure of paf - p-sulfonatocalix[8]arene complex
Alex, J.M. , Batta, G. , Crowley, P.B. , Engilberge, S. , Rennie, M.
Primary Citation of Related Structures: 6HAJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pc24g00380 protein | A | 55 | Penicillium Rubens Wisconsin 54-1255 | AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD |
| Pc24g00380 protein | B | 55 | Penicillium Rubens Wisconsin 54-1255 | AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-08-07 Deposition Author(s): Alex, J.M. , Batta, G. , Crowley, P.B. , Engilberge, S. , Rennie, M.