6GQN
Cell division regulator, s. pneumoniae gpsb, in complex with peptide fragment of penicillin binding protein pbp2a
PDB DOI: 10.2210/pdb6gqn/pdb
Classification: CELL CYCLE Organism(s): Human Immunodeficiency Virus Type 1 (Bh5 Isolate) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-06-07 Deposition Author(s): Lewis, R.J. , Rutter, Z.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Cell division regulator, s. pneumoniae gpsb, in complex with peptide fragment of penicillin binding protein pbp2a
Primary Citation of Related Structures: 6GQN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cell cycle protein GpsB | A | 62 | Human Immunodeficiency Virus Type 1 (Bh5 Isolate) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAALVKSLRQEIADLKEELTRK |
| Cell cycle protein GpsB | B | 62 | Human Immunodeficiency Virus Type 1 (Bh5 Isolate) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAALVKSLRQEIADLKEELTRK |
| SpPBP2a | C | 14 | Human Immunodeficiency Virus Type 1 (Bh5 Isolate) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TILRRSRSDRKKLA |
| SpPBP2a | G | 14 | Human Immunodeficiency Virus Type 1 (Bh5 Isolate) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TILRRSRSDRKKLA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-07 Deposition Author(s): Lewis, R.J. , Rutter, Z.J.