Cell division regulator, s. pneumoniae gpsb, in complex with peptide fragment of penicillin binding protein pbp2a
PDB DOI: 10.2210/pdb6gqn/pdb
Classification: CELL CYCLE Organism(s): Streptococcus Pneumoniae R6 , Synthetic Construct
Deposited: 2018-06-07 Deposition Author(s): Lewis, R.J. , Rutter, Z.J.
Cell division regulator, s. pneumoniae gpsb, in complex with peptide fragment of penicillin binding protein pbp2a
Primary Citation of Related Structures: 6GQN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cell cycle protein GpsB | A | 62 | Streptococcus Pneumoniae R6 , Synthetic Construct | GAIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAALVKSLRQEIADLKEELTRK |
| Cell cycle protein GpsB | B | 62 | Streptococcus Pneumoniae R6 , Synthetic Construct | GAIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAALVKSLRQEIADLKEELTRK |
| SpPBP2a | C | 14 | Streptococcus Pneumoniae R6 , Synthetic Construct | TILRRSRSDRKKLA |
| SpPBP2a | G | 14 | Streptococcus Pneumoniae R6 , Synthetic Construct | TILRRSRSDRKKLA |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-07 Deposition Author(s): Lewis, R.J. , Rutter, Z.J.