PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6GPZ

Cell division regulator gpsb in complex with peptide fragment of l. monocytogenes penicillin binding protein pbpa1

PDB DOI: 10.2210/pdb6gpz/pdb

Classification: CELL CYCLE
Organism(s): Ligusticum Chuanxiong , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2018-06-07
Deposition Author(s): Cleverley, R.M. , Lewis, R.J. , Rutter, Z.J.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.6 Å

6gpz
Literature

Cell division regulator gpsb in complex with peptide fragment of l. monocytogenes penicillin binding protein pbpa1

Cleverley, R.M. , Lewis, R.J. , Rutter, Z.J.

Primary Citation of Related Structures: 6GPZ


Proteins
Molecule Chains Sequence Length Organism Sequence
Cell cycle protein GpsB B 63 Ligusticum Chuanxiong , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GHMKVKLSAKEILEKEFKTGVRGYKQEDVDEFLDMIIKDYETFHQEIEELQQENLQLKKQLEE
Cell cycle protein GpsB A 63 Ligusticum Chuanxiong , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GHMKVKLSAKEILEKEFKTGVRGYKQEDVDEFLDMIIKDYETFHQEIEELQQENLQLKKQLEE
LmPBPA1 E 15 Ligusticum Chuanxiong , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) MADKPQTRSQYRNKQ
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2018-06-07
Deposition Author(s): Cleverley, R.M. , Lewis, R.J. , Rutter, Z.J.