Cell division regulator gpsb in complex with peptide fragment of l. monocytogenes penicillin binding protein pbpa1
PDB DOI: 10.2210/pdb6gpz/pdb
Classification: CELL CYCLE Organism(s): Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct
Deposited: 2018-06-07 Deposition Author(s): Cleverley, R.M. , Lewis, R.J. , Rutter, Z.J.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Cell division regulator gpsb in complex with peptide fragment of l. monocytogenes penicillin binding protein pbpa1
Cleverley, R.M. , Lewis, R.J. , Rutter, Z.J.
Primary Citation of Related Structures: 6GPZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cell cycle protein GpsB | B | 63 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | GHMKVKLSAKEILEKEFKTGVRGYKQEDVDEFLDMIIKDYETFHQEIEELQQENLQLKKQLEE |
Cell cycle protein GpsB | A | 63 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | GHMKVKLSAKEILEKEFKTGVRGYKQEDVDEFLDMIIKDYETFHQEIEELQQENLQLKKQLEE |
LmPBPA1 | E | 15 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | MADKPQTRSQYRNKQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-07 Deposition Author(s): Cleverley, R.M. , Lewis, R.J. , Rutter, Z.J.