6GPD
Crystal structure of the ligand-free form of domain 1 from tmargbp
PDB DOI: 10.2210/pdb6gpd/pdb
Classification: TRANSPORT PROTEIN Organism(s): Thermotoga Maritima Msb8
Deposited: 2018-06-05 Deposition Author(s): Balasco, N. , Berisio, R. , Ruggiero, A. , Smaldone, G. , Vitagliano, L.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Crystal structure of the ligand-free form of domain 1 from tmargbp
Balasco, N. , Berisio, R. , Ruggiero, A. , Smaldone, G. , Vitagliano, L.
Primary Citation of Related Structures: 6GPD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein | A | 126 | Thermotoga Maritima Msb8 | AIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGGGGSGEQYGIAVRKEDTDLLEFINSVLREL |
| Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein | B | 126 | Thermotoga Maritima Msb8 | AIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGGGGSGEQYGIAVRKEDTDLLEFINSVLREL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-05 Deposition Author(s): Balasco, N. , Berisio, R. , Ruggiero, A. , Smaldone, G. , Vitagliano, L.