14-3-3sigma in complex with a task3 peptide stabilized by semi-synthetic natural product fc-nac
PDB DOI: 10.2210/pdb6ghp/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2018-05-08 Deposition Author(s): Andrei, S.A. , Brunsveld, L. , De Vink, P.J. , Higuchi, Y. , Ottmann, C.
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
14-3-3sigma in complex with a task3 peptide stabilized by semi-synthetic natural product fc-nac
Andrei, S.A. , Brunsveld, L. , De Vink, P.J. , Higuchi, Y. , Ottmann, C.
Primary Citation of Related Structures: 6GHP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 14-3-3 protein sigma | A | 236 | Homo Sapiens , Synthetic Construct | GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT |
| Potassium channel subfamily K member 9 | P | 7 | Homo Sapiens , Synthetic Construct | XKRRKSV |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-08 Deposition Author(s): Andrei, S.A. , Brunsveld, L. , De Vink, P.J. , Higuchi, Y. , Ottmann, C.