Crystal structure of baz2a phd zinc finger in complex with fr 19
PDB DOI: 10.2210/pdb6fi0/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2018-01-16 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.
Crystal structure of baz2a phd zinc finger in complex with fr 19
Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.
Primary Citation of Related Structures: 6FI0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bromodomain adjacent to zinc finger domain protein 2A | A | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | B | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | C | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | D | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-01-16 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.