Crystal structure of human baz2b phd zinc finger in complex with fr 21
PDB DOI: 10.2210/pdb6fhq/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2018-01-15 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Crystal structure of human baz2b phd zinc finger in complex with fr 21
Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.
Primary Citation of Related Structures: 6FHQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain adjacent to zinc finger domain protein 2B | A | 58 | Homo Sapiens | HMSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKAS |
| Bromodomain adjacent to zinc finger domain protein 2B | B | 58 | Homo Sapiens | HMSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKAS |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-01-15 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.