Bik1 cap-gly domain with etf peptide from bim1
PDB DOI: 10.2210/pdb6fc6/pdb
Classification: CELL CYCLE Organism(s): Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-12-20 Deposition Author(s): Kumar, A. , Stangier, M.M. , Steinmetz, M.O.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Bik1 cap-gly domain with etf peptide from bim1
Kumar, A. , Stangier, M.M. , Steinmetz, M.O.
Primary Citation of Related Structures: 6FC6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nuclear fusion protein BIK1 | A | 102 | Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPMDRYQRKIGCFIQIPNLGRGQLKYVGPVDTKAGMFAGVDLLANIGKNDGSFMGKKYFQTEYPQSGLFIQLQKVASLIEKASISQTSRRTTMEPLSIPKNR |
Protein BIM1 | B | 11 | Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SNNLIIDEETF |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-12-20 Deposition Author(s): Kumar, A. , Stangier, M.M. , Steinmetz, M.O.