Crystal structure of the human retinoid x receptor dna-binding domain bound to the human mep dr1 response element, ph 4.2
PDB DOI: 10.2210/pdb6fbr/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-12-19 Deposition Author(s): Mcewen, A.G. , Osz, J. , Poussin-Courmontagne, P. , Rochel, N.
Crystal structure of the human retinoid x receptor dna-binding domain bound to the human mep dr1 response element, ph 4.2
Mcewen, A.G. , Osz, J. , Poussin-Courmontagne, P. , Rochel, N.
Primary Citation of Related Structures: 6FBR
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Retinoic acid receptor RXR-alpha | A | 87 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRG |
Retinoic acid receptor RXR-alpha | B | 87 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-12-19 Deposition Author(s): Mcewen, A.G. , Osz, J. , Poussin-Courmontagne, P. , Rochel, N.