Crystal structure of the human wnk2 cct-like 1 domain in complex with a wnk1 rfxv peptide
PDB DOI: 10.2210/pdb6fbk/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-12-19 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Bufton, J.C. , Bullock, A.N. , Burgess-Brown, N.A. , Edwards, A.M. , Pinkas, D.M.
Crystal structure of the human wnk2 cct-like 1 domain in complex with a wnk1 rfxv peptide
Arrowsmith, C.H. , Bountra, C. , Bufton, J.C. , Bullock, A.N. , Burgess-Brown, N.A. , Edwards, A.M. , Pinkas, D.M.
Primary Citation of Related Structures: 6FBK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Serine/threonine-protein kinase WNK2 | A | 98 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPA |
Serine/threonine-protein kinase WNK1 | P | 23 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LTQVVHSAGRRFIVSPVPESRLR |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-12-19 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Bufton, J.C. , Bullock, A.N. , Burgess-Brown, N.A. , Edwards, A.M. , Pinkas, D.M.