Crystal structure of the human wnk2 cct-like 1 domain in complex with a wnk1 rfxv peptide
PDB DOI: 10.2210/pdb6fbk/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-12-19 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Bufton, J.C. , Bullock, A.N. , Burgess-Brown, N.A. , Edwards, A.M. , Pinkas, D.M.
Method: X-RAY DIFFRACTION Resolution: 1.743 Å
Crystal structure of the human wnk2 cct-like 1 domain in complex with a wnk1 rfxv peptide
Arrowsmith, C.H. , Bountra, C. , Bufton, J.C. , Bullock, A.N. , Burgess-Brown, N.A. , Edwards, A.M. , Pinkas, D.M.
Primary Citation of Related Structures: 6FBK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine/threonine-protein kinase WNK2 | A | 98 | Homo Sapiens , Synthetic Construct | SMAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPA |
| Serine/threonine-protein kinase WNK1 | P | 23 | Homo Sapiens , Synthetic Construct | LTQVVHSAGRRFIVSPVPESRLR |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-12-19 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Bufton, J.C. , Bullock, A.N. , Burgess-Brown, N.A. , Edwards, A.M. , Pinkas, D.M.