6EXJ
Pdz domain from rat shank3 bound to the c terminus of somatostatin receptor subtype 2
PDB DOI: 10.2210/pdb6exj/pdb
Classification: PROTEIN BINDING Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-11-08 Deposition Author(s): Boeckers, T.M. , Keller, C. , Kursula, P. , Myllykoski, M. , Ponna, S.K. , Ruskamo, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Pdz domain from rat shank3 bound to the c terminus of somatostatin receptor subtype 2
Boeckers, T.M. , Keller, C. , Kursula, P. , Myllykoski, M. , Ponna, S.K. , Ruskamo, S.
Primary Citation of Related Structures: 6EXJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SH3 and multiple ankyrin repeat domains protein 3 | A | 96 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWKAGLRTGDFLIEVNGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVT |
| SH3 and multiple ankyrin repeat domains protein 3 | C | 96 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWKAGLRTGDFLIEVNGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVT |
| SSTR2 | B | 7 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XDLQTSI |
| SSTR2 | D | 7 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XDLQTSI |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-11-08 Deposition Author(s): Boeckers, T.M. , Keller, C. , Kursula, P. , Myllykoski, M. , Ponna, S.K. , Ruskamo, S.