Characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides
PDB DOI: 10.2210/pdb6evs/pdb
Classification: TRANSFERASE Organism(s): Bacillus Psychrosaccharolyticus
Deposited: 2017-11-02 Deposition Author(s): Acebal, C. , Arroyo, M. , De La Mata, I. , Fernandez-Lucas, J. , Fresco-Tabohada, A. , Mancheno, J.M. , Ramon, F.
Characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides
Acebal, C. , Arroyo, M. , De La Mata, I. , Fernandez-Lucas, J. , Fresco-Tabohada, A. , Mancheno, J.M. , Ramon, F.
Primary Citation of Related Structures: 6EVS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| N-deoxyribosyltransferase | A | 142 | Bacillus Psychrosaccharolyticus | MAKIYLASPFFNEEQLKHVSKAEQVLRDLGHTVFSPRENQLPEVEFGSFEWRTFVFKNDLEHIKWADITFGIIGDNYDDTGTAWELGASYILGKPVMLFSPTGEIINLMITDSLHAYFEDWNDVENYDFATLPIKPYLKAVK |
| N-deoxyribosyltransferase | B | 142 | Bacillus Psychrosaccharolyticus | MAKIYLASPFFNEEQLKHVSKAEQVLRDLGHTVFSPRENQLPEVEFGSFEWRTFVFKNDLEHIKWADITFGIIGDNYDDTGTAWELGASYILGKPVMLFSPTGEIINLMITDSLHAYFEDWNDVENYDFATLPIKPYLKAVK |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-11-02 Deposition Author(s): Acebal, C. , Arroyo, M. , De La Mata, I. , Fernandez-Lucas, J. , Fresco-Tabohada, A. , Mancheno, J.M. , Ramon, F.