Direct-evolutioned unspecific peroxygenase from agrocybe aegerita, in complex with veratryl alcohol
PDB DOI: 10.2210/pdb6el4/pdb
Classification: OXIDOREDUCTASE Organism(s): Agrocybe Aegerita
Deposited: 2017-09-27 Deposition Author(s): Ramirez-Escudero, M. , Sanz-Aparicio, J.
Direct-evolutioned unspecific peroxygenase from agrocybe aegerita, in complex with veratryl alcohol
Ramirez-Escudero, M. , Sanz-Aparicio, J.
Primary Citation of Related Structures: 6EL4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Aromatic peroxygenase | A | 328 | Agrocybe Aegerita | EPGLPPGPLENSSAKLVNDEAHPWKPLRPGDIRGPCPGLNTLASHGYLPRNGVATPAQIINAVQEGFNFDNQAAIFATYAAHLVDGNLITDLLSIGRKTRLTGPDPPPPASVGGLNEHGTFEGDASMTRGDAFFGNNHDFNETLFEQLVDYSNRFGGGKYNLTVAGELRFKRIQDSIATNPNFSFVDFRFFTAYGETTFPANLFVDGRRDDGQLDMDAARSFFQFSRMPDDFFRAPSPRSGTGVEVVVQAHPMQPGRNVGKINSYTVDPTSSDFSTPCLMYEKFVNITVKSLYPNPTVQLRKALNTNLDFLFQGVAAGCTQVFPYGRD |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-09-27 Deposition Author(s): Ramirez-Escudero, M. , Sanz-Aparicio, J.