Crystal structure of the bsd2 homolog of arabidopsis thaliana
PDB DOI: 10.2210/pdb6ekb/pdb
Classification: CHAPERONE Organism(s): Arabidopsis Thaliana
Deposited: 2017-09-26 Deposition Author(s): Aigner, H. , Bhat, J.Y. , Bracher, A. , Calisse, L. , Hartl, F.U. , Hayer-Hartl, M. , Wilson, R.H.
Crystal structure of the bsd2 homolog of arabidopsis thaliana
Aigner, H. , Bhat, J.Y. , Bracher, A. , Calisse, L. , Hartl, F.U. , Hayer-Hartl, M. , Wilson, R.H.
Primary Citation of Related Structures: 6EKB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DnaJ/Hsp40 cysteine-rich domain superfamily protein | A | 81 | Arabidopsis Thaliana | MAANNNPQGTKPNSLVCANCEGEGCVACSQCKGGGVNLIDHFNGQFKAGALCWLCRGKKEVLCGDCNGAGFIGGFLSTFDE |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-09-26 Deposition Author(s): Aigner, H. , Bhat, J.Y. , Bracher, A. , Calisse, L. , Hartl, F.U. , Hayer-Hartl, M. , Wilson, R.H.