Crystal structure of tyrosinase from bacillus megaterium with b5n inhibitor in the active site
PDB DOI: 10.2210/pdb6ei4/pdb
Classification: OXIDOREDUCTASE Organism(s): Bacillus Megaterium
Deposited: 2017-09-17 Deposition Author(s): Deri, B. , Fishman, A. , Gitto, R. , Pazy Benhar, Y.
Crystal structure of tyrosinase from bacillus megaterium with b5n inhibitor in the active site
Deri, B. , Fishman, A. , Gitto, R. , Pazy Benhar, Y.
Primary Citation of Related Structures: 6EI4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosinase | A | 288 | Bacillus Megaterium | KYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAVWQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELR |
| Tyrosinase | B | 288 | Bacillus Megaterium | KYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAVWQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELR |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-09-17 Deposition Author(s): Deri, B. , Fishman, A. , Gitto, R. , Pazy Benhar, Y.