Solution structure of zzz3 zz domain in complex with histone h3k4ac peptide
PDB DOI: 10.2210/pdb6e86/pdb
Classification: GENE REGULATION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-07-27 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of zzz3 zz domain in complex with histone h3k4ac peptide
Primary Citation of Related Structures: 6E86
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ZZ-type zinc finger-containing protein 3 | B | 64 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYR |
H3K4ac | A | 8 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTAR |
Method: SOLUTION NMR
Deposited Date: 2018-07-27 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.