Solution structure of zzz3 zz domain in complex with histone h3k4ac peptide
PDB DOI: 10.2210/pdb6e86/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2018-07-27 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of zzz3 zz domain in complex with histone h3k4ac peptide
Primary Citation of Related Structures: 6E86
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ZZ-type zinc finger-containing protein 3 | B | 64 | Homo Sapiens , Synthetic Construct | GPLGSVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYR |
| H3K4ac | A | 8 | Homo Sapiens , Synthetic Construct | ARTKQTAR |
Method: SOLUTION NMR
Deposited Date: 2018-07-27 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.